PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00019815-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family FAR1
Protein Properties Length: 706aa    MW: 81023.8 Da    PI: 6.5056
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00019815-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR166.19.1e-21117206291
                   FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHel 89 
                             Y++YAk++ Fsvrk ++++ ++++e+ ++tfvCs+ g + +++ + + +  +++++r++C+a l++ + + g w+vt++ ++HnHel
  SMil_00019815-RA_Salv 117 LYCDYAKHTEFSVRKGNQERFNKTKEVRMKTFVCSCRGLTPTTHIEGRLAVYKKQSSRCNCQALLRIARVEGGPWKVTTFIKDHNHEL 204
                            59**************************************999999899999************************************ PP

                   FAR1  90 ap 91 
                            +p
  SMil_00019815-RA_Salv 205 FP 206
                            86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.7E-17117206IPR004330FAR1 DNA binding domain
PROSITE profilePS5096610.002418466IPR007527Zinc finger, SWIM-type
PfamPF044344.5E-4440459IPR007527Zinc finger, SWIM-type
SMARTSM005757.5E-4441468IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 706 aa     Download sequence    Send to blast
MVFDLNVPDG VDELEYYNSI VNDDAIDWGL NNVRNDEFSA YGFQMEEDVH VEDVNHVNVE  60
DVNHVNVEDV ESEFRHETED VANEVGHSTA VELEAVELEA KLTPGCLVDG FDEAFLLYCD  120
YAKHTEFSVR KGNQERFNKT KEVRMKTFVC SCRGLTPTTH IEGRLAVYKK QSSRCNCQAL  180
LRIARVEGGP WKVTTFIKDH NHELFPKDQT YLLRSSRHIS HTKKSMLEAL HSAGIPISHA  240
CRFMENEAGG PENAGFIHEA TETFEWLFSI FLESMNAKEP EVVFSNQCQA LMNGGLEVCT  300
NCARDGLQFS PILAFLLDSM LLRSNKVLKD LCASSGSLFD FVQKYEQIQK DWRVKERVAD  360
ALCIGTPGQF VEHNPLVMAA AKHFMRAVFV SYEFEANHSL NVSIIGNSTA DDVQQLRFVV  420
KTTTNPLRSR CVIFHRTSHE ASCSCRLWET SGILCRHIFR IYYHMNVKSI PKKYLLRRFS  480
KDAKTRIGLA IGEGNTGHTH CHILLPNSAM NSHIMCGMYE LLNDDKLDET SRQIIIHKFD  540
ELQKEIQLRL RAIRQVDTSH DDASIHNPNP LVRTPFHDPA IPVKRRFTNT RLSRHWERSK  600
KKGRKTRTAL GRELDCQATT SNNGNLVEDD HTRSTSRKSL HHELDFCFFS RLIQDPEVHW  660
DPLHNIMTMS DEVYASYLEV EPIIRGYKEH GEPMFFLLRG IYFVDE
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27110.23e-17FAR1-related sequence 3